PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.285270.1
Common NameCsa_5G604410, LOC101222056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 466aa    MW: 52357.3 Da    PI: 7.265
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.285270.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.8e-152266348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT++Ed++l + ++q+G+++W+ Ia+++   +t  qc+ rw++yl
   Cucsa.285270.1 22 SWTQQEDDILREQINQHGTENWAIIASKFK-DKTTRQCRRRWYTYL 66
                     6****************************9.*************97 PP

2Myb_DNA-binding45.22.2e-1472115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd+ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
   Cucsa.285270.1  72 KGGWSPEEDLLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFTT 115
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9881566IPR017930Myb domain
SMARTSM007178.3E-141968IPR001005SANT/Myb domain
SuperFamilySSF466897.86E-2620113IPR009057Homeodomain-like
CDDcd001671.12E-122266No hitNo description
Gene3DG3DSA:1.10.10.602.3E-202374IPR009057Homeodomain-like
PfamPF139214.3E-152382No hitNo description
PROSITE profilePS5129420.82867121IPR017930Myb domain
SMARTSM007173.9E-1571119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-1975120IPR009057Homeodomain-like
CDDcd001671.33E-1075116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MQDTKKKLAT EDSKKKERHI VSWTQQEDDI LREQINQHGT ENWAIIASKF KDKTTRQCRR  60
RWYTYLNSDF KKGGWSPEED LLLCEAQKIF GNRWTEIAKV VSGRTDNAVK NRFTTLCKKR  120
AKYEALAKEN SSSFINHNNK RVIFQKGSND VSSETSQPVK RIRRAHISHT TEGCSLEDGS  180
KKPELAVDQQ LRAPLAVLVE NSVDHADGQS ATAQSNKSQG TFIKKDDPKV TALTEQAELL  240
SSLALKVNSE NTDQSLENAW KILQDFLSRS KENNMRIPKY VTPDIDLQLE DAKGSVEDLR  300
SSNDGSQWRE PNLHESPGSS EYSTGSTLVS QTAEEKIDQS QPEIGTHHQE PQFESGSSCT  360
REQYNIGEST KEILPKTNLE RETFKCCNER KIESFASSFS SSEFSSPMHV IPLFRSLAAG  420
IPSPQFSESE RSFLLKTLGV ESPSLNPSVN PSQPPPCKRA LLQSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-272312110108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818961e-104LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132641e-104LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011655672.10.0PREDICTED: uncharacterized protein LOC101222056
TrEMBLA0A0A0KVW30.0A0A0A0KVW3_CUCSA; Uncharacterized protein
STRINGVIT_01s0026g01910.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.21e-171MYB family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]